2609: Revisiting Puzzle 125: Ice Binding Protein
Closed since 11 months ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- May 14, 2025
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
- Sequence
- ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA