Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 11 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,201
  2. Avatar for Go Science 2. Go Science 63 pts. 10,195
  3. Avatar for Contenders 3. Contenders 37 pts. 10,157
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,148
  5. Avatar for Australia 5. Australia 11 pts. 10,119
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 10,112
  7. Avatar for VeFold 7. VeFold 2 pts. 10,109
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,069
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,039
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,014

  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 10,200
  2. Avatar for SemperRabbit 2. SemperRabbit Lv 1 94 pts. 10,198
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 88 pts. 10,195
  4. Avatar for akaaka 4. akaaka Lv 1 83 pts. 10,181
  5. Avatar for Serca 5. Serca Lv 1 77 pts. 10,176
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 72 pts. 10,162
  7. Avatar for MicElephant 7. MicElephant Lv 1 68 pts. 10,157
  8. Avatar for LociOiling 8. LociOiling Lv 1 63 pts. 10,155
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 59 pts. 10,148
  10. Avatar for meatexplosion 10. meatexplosion Lv 1 55 pts. 10,145

Comments