Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,484
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,511
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,255
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,244

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,032
  2. Avatar for Serca 2. Serca Lv 1 95 pts. 10,897
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 89 pts. 10,840
  4. Avatar for MicElephant 4. MicElephant Lv 1 84 pts. 10,702
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 79 pts. 10,678
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 74 pts. 10,666
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 70 pts. 10,652
  8. Avatar for akaaka 8. akaaka Lv 1 66 pts. 10,644
  9. Avatar for orily1337 9. orily1337 Lv 1 62 pts. 10,576
  10. Avatar for Anfinsen_slept_here 10. Anfinsen_slept_here Lv 1 58 pts. 10,540

Comments