Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,032
  2. Avatar for Go Science 2. Go Science 68 pts. 10,902
  3. Avatar for Contenders 3. Contenders 44 pts. 10,702
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,576
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,524
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 10,432
  7. Avatar for Australia 7. Australia 5 pts. 10,370
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,369
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,330
  10. Avatar for VeFold 10. VeFold 1 pt. 10,215

  1. Avatar for zxspectrum 11. zxspectrum Lv 1 54 pts. 10,532
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 51 pts. 10,524
  3. Avatar for grogar7 13. grogar7 Lv 1 47 pts. 10,520
  4. Avatar for Galaxie 14. Galaxie Lv 1 44 pts. 10,511
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 41 pts. 10,496
  6. Avatar for gmn 16. gmn Lv 1 38 pts. 10,483
  7. Avatar for jausmh 17. jausmh Lv 1 36 pts. 10,465
  8. Avatar for Joanna_H 18. Joanna_H Lv 1 33 pts. 10,432
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 31 pts. 10,370
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 29 pts. 10,369

Comments