Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,032
  2. Avatar for Go Science 2. Go Science 68 pts. 10,902
  3. Avatar for Contenders 3. Contenders 44 pts. 10,702
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,576
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,524
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 10,432
  7. Avatar for Australia 7. Australia 5 pts. 10,370
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,369
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,330
  10. Avatar for VeFold 10. VeFold 1 pt. 10,215

  1. Avatar for JuliaBCollet 31. JuliaBCollet Lv 1 12 pts. 10,139
  2. Avatar for nicobul 32. nicobul Lv 1 11 pts. 10,137
  3. Avatar for drumpeter18yrs9yrs 33. drumpeter18yrs9yrs Lv 1 10 pts. 10,117
  4. Avatar for jamiexq 34. jamiexq Lv 1 9 pts. 10,103
  5. Avatar for LHOr 35. LHOr Lv 1 8 pts. 10,099
  6. Avatar for heather-1 36. heather-1 Lv 1 8 pts. 10,055
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 7 pts. 10,037
  8. Avatar for BarrySampson 38. BarrySampson Lv 1 6 pts. 10,032
  9. Avatar for ludus9 39. ludus9 Lv 1 6 pts. 10,019
  10. Avatar for Apothecary1815 40. Apothecary1815 Lv 1 5 pts. 9,843

Comments