Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,032
  2. Avatar for Go Science 2. Go Science 68 pts. 10,902
  3. Avatar for Contenders 3. Contenders 44 pts. 10,702
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,576
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,524
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 10,432
  7. Avatar for Australia 7. Australia 5 pts. 10,370
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,369
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,330
  10. Avatar for VeFold 10. VeFold 1 pt. 10,215

  1. Avatar for pfirth 41. pfirth Lv 1 5 pts. 9,820
  2. Avatar for Idiotboy 42. Idiotboy Lv 1 4 pts. 9,797
  3. Avatar for pizpot 43. pizpot Lv 1 4 pts. 9,758
  4. Avatar for badgoes 44. badgoes Lv 1 3 pts. 9,663
  5. Avatar for CAN1958 45. CAN1958 Lv 1 3 pts. 9,635
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 3 pts. 9,635
  7. Avatar for toshiue 47. toshiue Lv 1 3 pts. 9,568
  8. Avatar for carxo 48. carxo Lv 1 2 pts. 9,549
  9. Avatar for hada 49. hada Lv 1 2 pts. 9,503
  10. Avatar for Gerom 50. Gerom Lv 1 2 pts. 9,484

Comments