Placeholder image of a protein
Icon representing a puzzle

2624: Electron Density Reconstruction 123

Closed since 9 months ago

Novice Overall Prediction Electron Density

Summary

Created
June 11, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You might be wondering how this protein is stable- it's not the whole protein, just the part that was crystallized for solving, hence the strange shape. It's big, so the Trim tool is recommended.

Sequence
RTEQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEQSAAAAAALEEQASRLTEAVAVFRIQQQ

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 57,685
  2. Avatar for Go Science 2. Go Science 47 pts. 57,654
  3. Avatar for VeFold 3. VeFold 19 pts. 57,630
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 7 pts. 57,620
  5. Avatar for Contenders 5. Contenders 2 pts. 57,592
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 57,263
  7. Avatar for Australia 7. Australia 1 pt. 57,003
  8. Avatar for Team China 8. Team China 1 pt. 52,853
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 57,620
  2. Avatar for Galaxie 2. Galaxie Lv 1 41 pts. 57,618
  3. Avatar for alcor29 3. alcor29 Lv 1 14 pts. 57,601
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 4 pts. 57,592
  5. Avatar for toshiue 5. toshiue Lv 1 1 pt. 57,563
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 57,547
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 1 pt. 57,233

Comments