Placeholder image of a protein
Icon representing a puzzle

2624: Electron Density Reconstruction 123

Closed since 10 months ago

Novice Overall Prediction Electron Density

Summary


Created
June 11, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You might be wondering how this protein is stable- it's not the whole protein, just the part that was crystallized for solving, hence the strange shape. It's big, so the Trim tool is recommended.

Sequence
RTEQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEQSAAAAAALEEQASRLTEAVAVFRIQQQ

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 57,685
  2. Avatar for Go Science 2. Go Science 47 pts. 57,654
  3. Avatar for VeFold 3. VeFold 19 pts. 57,630
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 7 pts. 57,620
  5. Avatar for Contenders 5. Contenders 2 pts. 57,592
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 57,263
  7. Avatar for Australia 7. Australia 1 pt. 57,003
  8. Avatar for Team China 8. Team China 1 pt. 52,853

  1. Avatar for meatexplosion 11. meatexplosion Lv 1 43 pts. 57,308
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 39 pts. 57,275
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 35 pts. 57,263
  4. Avatar for gmn 14. gmn Lv 1 32 pts. 57,237
  5. Avatar for vs 15. vs Lv 1 29 pts. 57,120
  6. Avatar for SemperRabbit 16. SemperRabbit Lv 1 26 pts. 57,098
  7. Avatar for g_b 17. g_b Lv 1 24 pts. 57,071
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 21 pts. 57,003
  9. Avatar for grogar7 19. grogar7 Lv 1 19 pts. 56,967
  10. Avatar for zxspectrum 20. zxspectrum Lv 1 17 pts. 56,953

Comments