Placeholder image of a protein
Icon representing a puzzle

2624: Electron Density Reconstruction 123

Closed since 10 months ago

Novice Overall Prediction Electron Density

Summary


Created
June 11, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You might be wondering how this protein is stable- it's not the whole protein, just the part that was crystallized for solving, hence the strange shape. It's big, so the Trim tool is recommended.

Sequence
RTEQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEQSAAAAAALEEQASRLTEAVAVFRIQQQ

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 57,685
  2. Avatar for Go Science 2. Go Science 47 pts. 57,654
  3. Avatar for VeFold 3. VeFold 19 pts. 57,630
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 7 pts. 57,620
  5. Avatar for Contenders 5. Contenders 2 pts. 57,592
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 57,263
  7. Avatar for Australia 7. Australia 1 pt. 57,003
  8. Avatar for Team China 8. Team China 1 pt. 52,853

  1. Avatar for abiogenesis 41. abiogenesis Lv 1 1 pt. 55,202
  2. Avatar for Trajan464 42. Trajan464 Lv 1 1 pt. 55,061
  3. Avatar for zbp 43. zbp Lv 1 1 pt. 55,035
  4. Avatar for Merf 44. Merf Lv 1 1 pt. 54,986
  5. Avatar for Larini 45. Larini Lv 1 1 pt. 54,673
  6. Avatar for RichGuilmain 46. RichGuilmain Lv 1 1 pt. 54,569
  7. Avatar for hookedwarm 47. hookedwarm Lv 1 1 pt. 54,491
  8. Avatar for RWoodcock 48. RWoodcock Lv 1 1 pt. 54,317
  9. Avatar for haleyg 49. haleyg Lv 1 1 pt. 54,298
  10. Avatar for Mohoernchen 50. Mohoernchen Lv 1 1 pt. 54,263

Comments