Icon representing a puzzle

2623: Revisiting Puzzle 137: Rosetta Decoy

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
June 18, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Firesign 11. Firesign 1 pt. 9,640
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,075
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 11,793
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 11,777
  4. Avatar for akaaka 4. akaaka Lv 1 82 pts. 11,706
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 76 pts. 11,631
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 71 pts. 11,590
  7. Avatar for g_b 7. g_b Lv 1 66 pts. 11,588
  8. Avatar for gmn 8. gmn Lv 1 61 pts. 11,577
  9. Avatar for AlkiP0Ps 9. AlkiP0Ps Lv 1 56 pts. 11,563
  10. Avatar for orily1337 10. orily1337 Lv 1 52 pts. 11,544

Comments