Icon representing a puzzle

2623: Revisiting Puzzle 137: Rosetta Decoy

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 18, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,075
  2. Avatar for Go Science 2. Go Science 60 pts. 11,793
  3. Avatar for Australia 3. Australia 33 pts. 11,563
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 11,544
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 11,540
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 11,511
  7. Avatar for Contenders 7. Contenders 2 pts. 11,429
  8. Avatar for VeFold 8. VeFold 1 pt. 11,363
  9. Avatar for Team China 9. Team China 1 pt. 10,097
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 9,869

  1. Avatar for RWoodcock 61. RWoodcock Lv 1 1 pt. 10,217
  2. Avatar for jdmclure 62. jdmclure Lv 1 1 pt. 10,188
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 10,178
  4. Avatar for mart0258 64. mart0258 Lv 1 1 pt. 10,128
  5. Avatar for lezhe 65. lezhe Lv 1 1 pt. 10,097
  6. Avatar for Swapper242 66. Swapper242 Lv 1 1 pt. 9,941
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 9,878
  8. Avatar for Sammy3c2b1a0 68. Sammy3c2b1a0 Lv 1 1 pt. 9,869
  9. Avatar for NickDanger 69. NickDanger Lv 1 1 pt. 9,640
  10. Avatar for azzencrusher 70. azzencrusher Lv 1 1 pt. 8,585

Comments