Placeholder image of a protein
Icon representing a puzzle

2627: Electron Density Reconstruction 124

Closed since 11 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two copies of the protein here and it's big, so Trim tool is highly recommended.

Sequence
MGHHHHHHMLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK

Top groups


  1. Avatar for VeFold
    1. VeFold
    100 pts. 70,136
  2. Avatar for Go Science 2. Go Science 56 pts. 69,086
  3. Avatar for Contenders 3. Contenders 29 pts. 68,867
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 14 pts. 67,859
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 6 pts. 65,311
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 62,698
  7. Avatar for Australia 7. Australia 1 pt. 62,271
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 57,989
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 1 pt. 22,909
  10. Avatar for Foldit Staff 10. Foldit Staff 1 pt. 0

  1. Avatar for grogar7 11. grogar7 Lv 1 45 pts. 63,817
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 41 pts. 62,698
  3. Avatar for g_b 13. g_b Lv 1 38 pts. 62,485
  4. Avatar for meatexplosion 14. meatexplosion Lv 1 35 pts. 62,392
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 31 pts. 62,271
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 29 pts. 61,301
  7. Avatar for alcor29 17. alcor29 Lv 1 26 pts. 60,692
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 24 pts. 60,006
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 21 pts. 59,374
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 19 pts. 59,107

Comments


ZeroLeak7 Lv 1

would be nice if we had more time for this Puzzle 2627! so many residues 850 nearly doubled the number of residues and of course the same time as the last Puzzle with less residues.

Bruno Kestemont Lv 1

The trim tool doesn't help to reduce the delay needed to find a reasonable solution.

(dividing the number residues by n multiplies the performance of a given action bij n, but we need to do the action n times in order to cover the all protein).