Placeholder image of a protein
Icon representing a puzzle

2627: Electron Density Reconstruction 124

Closed since 11 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two copies of the protein here and it's big, so Trim tool is highly recommended.

Sequence
MGHHHHHHMLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK

Top groups


  1. Avatar for VeFold
    1. VeFold
    100 pts. 70,136
  2. Avatar for Go Science 2. Go Science 56 pts. 69,086
  3. Avatar for Contenders 3. Contenders 29 pts. 68,867
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 14 pts. 67,859
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 6 pts. 65,311
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 62,698
  7. Avatar for Australia 7. Australia 1 pt. 62,271
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 57,989
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 1 pt. 22,909
  10. Avatar for Foldit Staff 10. Foldit Staff 1 pt. 0

  1. Avatar for SemperRabbit 21. SemperRabbit Lv 1 17 pts. 58,766
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 16 pts. 58,181
  3. Avatar for TheGUmmer 23. TheGUmmer Lv 1 14 pts. 57,989
  4. Avatar for drumpeter18yrs9yrs 24. drumpeter18yrs9yrs Lv 1 13 pts. 57,821
  5. Avatar for vs 25. vs Lv 1 11 pts. 57,718
  6. Avatar for Trajan464 26. Trajan464 Lv 1 10 pts. 57,502
  7. Avatar for manu8170 27. manu8170 Lv 1 9 pts. 56,604
  8. Avatar for jamiexq 28. jamiexq Lv 1 8 pts. 56,517
  9. Avatar for toshiue 29. toshiue Lv 1 7 pts. 56,488
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 6 pts. 56,395

Comments


ZeroLeak7 Lv 1

would be nice if we had more time for this Puzzle 2627! so many residues 850 nearly doubled the number of residues and of course the same time as the last Puzzle with less residues.

Bruno Kestemont Lv 1

The trim tool doesn't help to reduce the delay needed to find a reasonable solution.

(dividing the number residues by n multiplies the performance of a given action bij n, but we need to do the action n times in order to cover the all protein).