Placeholder image of a protein
Icon representing a puzzle

2627: Electron Density Reconstruction 124

Closed since 9 months ago

Novice Overall Prediction Electron Density

Summary

Created
June 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two copies of the protein here and it's big, so Trim tool is highly recommended.

Sequence
MGHHHHHHMLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVK

Top groups

  1. Avatar for VeFold
    1. VeFold
    100 pts. 70,136
  2. Avatar for Go Science 2. Go Science 56 pts. 69,086
  3. Avatar for Contenders 3. Contenders 29 pts. 68,867
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 14 pts. 67,859
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 6 pts. 65,311
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 62,698
  7. Avatar for Australia 7. Australia 1 pt. 62,271
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 57,989
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 1 pt. 22,909
  10. Avatar for Foldit Staff 10. Foldit Staff 1 pt. 0
  1. Avatar for ProteinShake 31. ProteinShake Lv 1 6 pts. 56,195
  2. Avatar for georg137 32. georg137 Lv 1 5 pts. 55,977
  3. Avatar for nicobul 33. nicobul Lv 1 4 pts. 55,925
  4. Avatar for zxspectrum 34. zxspectrum Lv 1 4 pts. 55,713
  5. Avatar for hada 35. hada Lv 1 3 pts. 55,229
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 3 pts. 55,031
  7. Avatar for zbp 37. zbp Lv 1 3 pts. 52,675
  8. Avatar for Mohoernchen 38. Mohoernchen Lv 1 2 pts. 50,808
  9. Avatar for Hellcat6 39. Hellcat6 Lv 1 2 pts. 50,604
  10. Avatar for abiogenesis 40. abiogenesis Lv 1 2 pts. 50,534

Comments

ZeroLeak7 Lv 1

would be nice if we had more time for this Puzzle 2627! so many residues 850 nearly doubled the number of residues and of course the same time as the last Puzzle with less residues.

Bruno Kestemont Lv 1

The trim tool doesn't help to reduce the delay needed to find a reasonable solution.

(dividing the number residues by n multiplies the performance of a given action bij n, but we need to do the action n times in order to cover the all protein).