Placeholder image of a protein
Icon representing a puzzle

2630: Electron Density Reconstruction 125

Closed since 9 months ago

Novice Overall Prediction Electron Density

Summary


Created
June 26, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's three separate protein chains here, one really big one and two smaller, so the Trim tool is recommended.

Sequence
MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLRERTSELHPAIAKLLNK MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 57,618
  2. Avatar for Contenders 2. Contenders 56 pts. 57,587
  3. Avatar for Go Science 3. Go Science 29 pts. 57,322
  4. Avatar for VeFold 4. VeFold 14 pts. 57,288
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 6 pts. 57,248
  6. Avatar for Australia 6. Australia 2 pts. 56,361
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 56,288
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 54,240
  9. Avatar for Firesign 9. Firesign 1 pt. 18,647
  10. Avatar for Foldit Staff 10. Foldit Staff 1 pt. 11,847

  1. Avatar for DScott 51. DScott Lv 1 1 pt. 51,776
  2. Avatar for LHOr 52. LHOr Lv 1 1 pt. 51,718
  3. Avatar for rinze 53. rinze Lv 1 1 pt. 51,706
  4. Avatar for efull 54. efull Lv 1 1 pt. 51,644
  5. Avatar for Jenot96 55. Jenot96 Lv 1 1 pt. 51,472
  6. Avatar for Alistair69 56. Alistair69 Lv 1 1 pt. 51,426
  7. Avatar for furi0us 57. furi0us Lv 1 1 pt. 48,342
  8. Avatar for foizshiqer 58. foizshiqer Lv 1 1 pt. 46,395
  9. Avatar for thewholeblahthing 59. thewholeblahthing Lv 1 1 pt. 38,427
  10. Avatar for Laudrup18 60. Laudrup18 Lv 1 1 pt. 31,807

Comments


LociOiling Lv 1

This puzzle is a good match for PDB 1RH5. The amino acid sequence also matches PDB 1RHZ and others.

Although the description mentions three chains, AA Edit 3.0 and related recipes will report four chains. This is because chain A has 12 missing residues, amino acids that weren't located in the experimental data. This puzzle handles the missing residues correctly, by not connecting the sides of the gap. At segment 348, there's a gap, then segment 349 starts what the recipes call chain B (really the end of chain A).

The gap in chain A corresponds to the results for PDB 1RH5. While PDB 1RHZ has the same sequence, it doesn't have the same gap in chain A.

Some previous puzzles connected the sides of a missing residue gap with a peptide bond, which created a "pucker" with high negative ideality. The presence of puckers made the scientific results questionable, since the pucker tended to pull many adjacent segments out of position.

No puckers in 2630!