Placeholder image of a protein
Icon representing a puzzle

2633: Electron Density Reconstruction 126

Closed since 8 months ago

Novice Overall Prediction Electron Density

Summary


Created
July 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is related to the one given previously in 2631, so many facets will look similar. There's three separate protein chains here, one really big one and two smaller, so the Trim tool is recommended.

Sequence
MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKLLNK MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL

Top groups


  1. Avatar for Bioqué? 11. Bioqué? 1 pt. 41,928

  1. Avatar for Dr. Goochie
    1. Dr. Goochie Lv 1
    100 pts. 53,420
  2. Avatar for spvincent 2. spvincent Lv 1 92 pts. 52,810
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 84 pts. 52,481
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 77 pts. 52,403
  5. Avatar for georg137 5. georg137 Lv 1 70 pts. 52,198
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 64 pts. 52,190
  7. Avatar for akaaka 7. akaaka Lv 1 58 pts. 52,062
  8. Avatar for gmn 8. gmn Lv 1 53 pts. 52,024
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 48 pts. 52,014
  10. Avatar for LociOiling 10. LociOiling Lv 1 44 pts. 52,005

Comments


LociOiling Lv 1

It looks like this week's puzzle is PDB 1RHZ. It's basically the same as last week's puzzle, but without the missing residue gap in chain A.

PDB 1RH5 is the version with 12 missing residues in chain A, and it appeared in last week's Puzzle 2630.