Placeholder image of a protein
Icon representing a puzzle

2633: Electron Density Reconstruction 126

Closed since 8 months ago

Novice Overall Prediction Electron Density

Summary

Created
July 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is related to the one given previously in 2631, so many facets will look similar. There's three separate protein chains here, one really big one and two smaller, so the Trim tool is recommended.

Sequence
MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKLLNK MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 53,039
  2. Avatar for Go Science 2. Go Science 60 pts. 52,501
  3. Avatar for VeFold 3. VeFold 33 pts. 52,481
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 17 pts. 52,024
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 52,014
  6. Avatar for Australia 6. Australia 4 pts. 51,621
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 50,571
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 50,184
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 49,150
  10. Avatar for Team China 10. Team China 1 pt. 45,094
  1. Avatar for muffnerk 31. muffnerk Lv 1 3 pts. 49,134
  2. Avatar for Dr.Sillem 32. Dr.Sillem Lv 1 3 pts. 49,101
  3. Avatar for Trajan464 33. Trajan464 Lv 1 2 pts. 48,905
  4. Avatar for Idiotboy 34. Idiotboy Lv 1 2 pts. 48,815
  5. Avatar for vybi 35. vybi Lv 1 2 pts. 48,682
  6. Avatar for hada 36. hada Lv 1 1 pt. 48,588
  7. Avatar for jamiexq 37. jamiexq Lv 1 1 pt. 48,169
  8. Avatar for SuperEnzyme 38. SuperEnzyme Lv 1 1 pt. 47,884
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 1 pt. 47,448
  10. Avatar for Osiris 40. Osiris Lv 1 1 pt. 46,806

Comments

LociOiling Lv 1

It looks like this week's puzzle is PDB 1RHZ. It's basically the same as last week's puzzle, but without the missing residue gap in chain A.

PDB 1RH5 is the version with 12 missing residues in chain A, and it appeared in last week's Puzzle 2630.