Icon representing a puzzle

2632: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since 9 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 10,086
  2. Avatar for Firesign 12. Firesign 1 pt. 10,073
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,022
  4. Avatar for Team China 14. Team China 1 pt. 9,787
  5. Avatar for Window Group 15. Window Group 1 pt. 8,820

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,749
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 11,684
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 11,554
  4. Avatar for gmn 4. gmn Lv 1 82 pts. 11,488
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 76 pts. 11,482
  6. Avatar for MicElephant 6. MicElephant Lv 1 71 pts. 11,434
  7. Avatar for akaaka 7. akaaka Lv 1 66 pts. 11,427
  8. Avatar for SemperRabbit 8. SemperRabbit Lv 1 61 pts. 11,420
  9. Avatar for grogar7 9. grogar7 Lv 1 57 pts. 11,385
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 53 pts. 11,379

Comments