Icon representing a puzzle

2632: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
July 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 10,086
  2. Avatar for Firesign 12. Firesign 1 pt. 10,073
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,022
  4. Avatar for Team China 14. Team China 1 pt. 9,787
  5. Avatar for Window Group 15. Window Group 1 pt. 8,820
  1. Avatar for Dr. Goochie 11. Dr. Goochie Lv 1 49 pts. 11,369
  2. Avatar for georg137 12. georg137 Lv 1 45 pts. 11,352
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 42 pts. 11,345
  4. Avatar for Galaxie 14. Galaxie Lv 1 39 pts. 11,342
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 36 pts. 11,336
  6. Avatar for g_b 16. g_b Lv 1 33 pts. 11,308
  7. Avatar for BarrySampson 17. BarrySampson Lv 1 30 pts. 11,290
  8. Avatar for TheGUmmer 18. TheGUmmer Lv 1 28 pts. 11,283
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 25 pts. 11,261
  10. Avatar for Anfinsen_slept_here 20. Anfinsen_slept_here Lv 1 23 pts. 11,260

Comments