Icon representing a puzzle

2632: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
July 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 10,086
  2. Avatar for Firesign 12. Firesign 1 pt. 10,073
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,022
  4. Avatar for Team China 14. Team China 1 pt. 9,787
  5. Avatar for Window Group 15. Window Group 1 pt. 8,820
  1. Avatar for orily1337 21. orily1337 Lv 1 21 pts. 11,246
  2. Avatar for meatexplosion 22. meatexplosion Lv 1 19 pts. 11,239
  3. Avatar for alcor29 23. alcor29 Lv 1 18 pts. 11,239
  4. Avatar for vs 24. vs Lv 1 16 pts. 11,229
  5. Avatar for toshiue 25. toshiue Lv 1 15 pts. 11,177
  6. Avatar for vybi 26. vybi Lv 1 13 pts. 11,172
  7. Avatar for SuperEnzyme 27. SuperEnzyme Lv 1 12 pts. 11,168
  8. Avatar for hada 28. hada Lv 1 11 pts. 11,166
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 10 pts. 11,149
  10. Avatar for nicobul 30. nicobul Lv 1 9 pts. 11,144

Comments