Icon representing a puzzle

2632: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
July 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 10,086
  2. Avatar for Firesign 12. Firesign 1 pt. 10,073
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,022
  4. Avatar for Team China 14. Team China 1 pt. 9,787
  5. Avatar for Window Group 15. Window Group 1 pt. 8,820

  1. Avatar for Apothecary1815 31. Apothecary1815 Lv 1 8 pts. 11,105
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 7 pts. 11,098
  3. Avatar for manu8170 33. manu8170 Lv 1 6 pts. 11,058
  4. Avatar for Dr.Sillem 34. Dr.Sillem Lv 1 6 pts. 11,053
  5. Avatar for jamiexq 35. jamiexq Lv 1 5 pts. 11,049
  6. Avatar for thewholeblahthing 36. thewholeblahthing Lv 1 5 pts. 11,046
  7. Avatar for stomjoh 37. stomjoh Lv 1 4 pts. 11,042
  8. Avatar for Larini 38. Larini Lv 1 4 pts. 11,022
  9. Avatar for SileNTViP 39. SileNTViP Lv 1 3 pts. 11,007
  10. Avatar for hansvandenhof 40. hansvandenhof Lv 1 3 pts. 10,977

Comments