Icon representing a puzzle

2632: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since 10 months ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 10,086
  2. Avatar for Firesign 12. Firesign 1 pt. 10,073
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,022
  4. Avatar for Team China 14. Team China 1 pt. 9,787
  5. Avatar for Window Group 15. Window Group 1 pt. 8,820

  1. Avatar for LHOr 41. LHOr Lv 1 3 pts. 10,964
  2. Avatar for zxspectrum 42. zxspectrum Lv 1 2 pts. 10,933
  3. Avatar for heather-1 43. heather-1 Lv 1 2 pts. 10,891
  4. Avatar for rosie4loop 44. rosie4loop Lv 1 2 pts. 10,847
  5. Avatar for hookedwarm 45. hookedwarm Lv 1 2 pts. 10,844
  6. Avatar for apetrides 46. apetrides Lv 1 1 pt. 10,781
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 10,768
  8. Avatar for muffnerk 48. muffnerk Lv 1 1 pt. 10,760
  9. Avatar for Oscar JV 49. Oscar JV Lv 1 1 pt. 10,758
  10. Avatar for ppp6 50. ppp6 Lv 1 1 pt. 10,736

Comments