Icon representing a puzzle

2632: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since 9 months ago

Novice Overall Prediction

Summary


Created
July 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,554
  3. Avatar for Contenders 3. Contenders 47 pts. 11,434
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,379
  5. Avatar for VeFold 5. VeFold 19 pts. 11,290
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,283
  7. Avatar for Australia 7. Australia 7 pts. 11,261
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,246
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 2 pts. 11,098
  10. Avatar for Bioqué? 10. Bioqué? 1 pt. 10,418

  1. Avatar for orily1337 21. orily1337 Lv 1 21 pts. 11,246
  2. Avatar for meatexplosion 22. meatexplosion Lv 1 19 pts. 11,239
  3. Avatar for alcor29 23. alcor29 Lv 1 18 pts. 11,239
  4. Avatar for vs 24. vs Lv 1 16 pts. 11,229
  5. Avatar for toshiue 25. toshiue Lv 1 15 pts. 11,177
  6. Avatar for vybi 26. vybi Lv 1 13 pts. 11,172
  7. Avatar for SuperEnzyme 27. SuperEnzyme Lv 1 12 pts. 11,168
  8. Avatar for hada 28. hada Lv 1 11 pts. 11,166
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 10 pts. 11,149
  10. Avatar for nicobul 30. nicobul Lv 1 9 pts. 11,144

Comments