Icon representing a puzzle

2632: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,554
  3. Avatar for Contenders 3. Contenders 47 pts. 11,434
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,379
  5. Avatar for VeFold 5. VeFold 19 pts. 11,290
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,283
  7. Avatar for Australia 7. Australia 7 pts. 11,261
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,246
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 2 pts. 11,098
  10. Avatar for Bioqué? 10. Bioqué? 1 pt. 10,418
  1. Avatar for RegnadKcin 71. RegnadKcin Lv 1 1 pt. 10,073
  2. Avatar for furi0us 72. furi0us Lv 1 1 pt. 10,022
  3. Avatar for Sammy3c2b1a0 73. Sammy3c2b1a0 Lv 1 1 pt. 10,022
  4. Avatar for zo3xiaJonWeinberg 74. zo3xiaJonWeinberg Lv 1 1 pt. 9,787
  5. Avatar for jflat06 75. jflat06 Lv 1 1 pt. 8,820

Comments