Placeholder image of a protein
Icon representing a puzzle

2636: Electron Density Reconstruction 127

Closed since 9 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
July 13, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MRGSPRTKDRLAALKAAVSDEEDVEEVAVQVDSGGGFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSAPQTDDQMKEELEELMTDIKRTANKVRGKLKTIELNIEQEEHSNKSSADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKARIKRQMEITGRTTTNEELEDMLESG

Top groups


  1. Avatar for Go Science 100 pts. 33,770
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 33,695
  3. Avatar for VeFold 3. VeFold 29 pts. 33,687
  4. Avatar for Contenders 4. Contenders 14 pts. 33,615
  5. Avatar for Australia 5. Australia 6 pts. 33,504
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 33,429
  7. Avatar for Void Crushers 7. Void Crushers 1 pt. 33,349
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 33,271
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 32,866
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 32,520

  1. Avatar for carxo 51. carxo Lv 1 1 pt. 31,576
  2. Avatar for DScott 52. DScott Lv 1 1 pt. 31,434
  3. Avatar for RWoodcock 53. RWoodcock Lv 1 1 pt. 31,258
  4. Avatar for furi0us 54. furi0us Lv 1 1 pt. 31,139
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 31,111
  6. Avatar for muffnerk 56. muffnerk Lv 1 1 pt. 30,601
  7. Avatar for thewholeblahthing 57. thewholeblahthing Lv 1 1 pt. 29,664
  8. Avatar for helon 58. helon Lv 1 1 pt. 29,112

Comments


bravosk8erboy Lv 1

once again puzzle #2636 also has scoring bug with trim & untrim on terminal segments. for me selecting the following segments: 1, 36, 37, 70, 71, 109, 110, 183, 184, 227 then doing a trim and untrim led to a total point loss of -530 points.
weirdly segments 35, and 182 gave me a 12.379 total point gain.

the following recipe can be used to find the segment index for these issues. it will show a false positive for segments next to the terminal segment because it still gets trimmed.
https://fold.it/recipes/109092

beta_helix Staff Lv 1

Thank you for reporting this, bravosk8erboy… hopefully we can figure out what is going on with the Trim Tool.

NOTE: this puzzle was incorrectly opened for 1 extra day, which is why the closing date has been correctly updated to July 24th. Sorry for this mistake.