Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,771
  2. Avatar for Bioqué? 12. Bioqué? 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,483
  4. Avatar for Firesign 14. Firesign 1 pt. 9,348
  1. Avatar for Dr. Goochie 11. Dr. Goochie Lv 1 51 pts. 11,961
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 47 pts. 11,952
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 44 pts. 11,951
  4. Avatar for grogar7 14. grogar7 Lv 1 41 pts. 11,943
  5. Avatar for zxspectrum 15. zxspectrum Lv 1 38 pts. 11,935
  6. Avatar for LHOr 16. LHOr Lv 1 35 pts. 11,933
  7. Avatar for Tehnologik1 17. Tehnologik1 Lv 1 32 pts. 11,933
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 30 pts. 11,930
  9. Avatar for Galaxie 19. Galaxie Lv 1 27 pts. 11,906
  10. Avatar for meatexplosion 20. meatexplosion Lv 1 25 pts. 11,891

Comments