Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,771
  2. Avatar for Bioqué? 12. Bioqué? 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,483
  4. Avatar for Firesign 14. Firesign 1 pt. 9,348
  1. Avatar for g_b 21. g_b Lv 1 23 pts. 11,877
  2. Avatar for orily1337 22. orily1337 Lv 1 21 pts. 11,865
  3. Avatar for montezumasrevenge 23. montezumasrevenge Lv 1 20 pts. 11,847
  4. Avatar for TheGUmmer 24. TheGUmmer Lv 1 18 pts. 11,823
  5. Avatar for hookedwarm 25. hookedwarm Lv 1 16 pts. 11,800
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 15 pts. 11,790
  7. Avatar for Dr.Sillem 27. Dr.Sillem Lv 1 14 pts. 11,704
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 12 pts. 11,675
  9. Avatar for heather-1 29. heather-1 Lv 1 11 pts. 11,653
  10. Avatar for taiunplant 30. taiunplant Lv 1 10 pts. 11,635

Comments