Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,771
  2. Avatar for Bioqué? 12. Bioqué? 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,483
  4. Avatar for Firesign 14. Firesign 1 pt. 9,348
  1. Avatar for Osiris 41. Osiris Lv 1 3 pts. 11,347
  2. Avatar for pfirth 42. pfirth Lv 1 3 pts. 11,343
  3. Avatar for hada 43. hada Lv 1 3 pts. 11,337
  4. Avatar for drumpeter18yrs9yrs 44. drumpeter18yrs9yrs Lv 1 2 pts. 11,299
  5. Avatar for SWR_DMaster 45. SWR_DMaster Lv 1 2 pts. 11,208
  6. Avatar for zbp 46. zbp Lv 1 2 pts. 11,194
  7. Avatar for Greg60 47. Greg60 Lv 1 2 pts. 11,170
  8. Avatar for Trajan464 48. Trajan464 Lv 1 1 pt. 11,144
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 1 pt. 11,130
  10. Avatar for Hellcat6 50. Hellcat6 Lv 1 1 pt. 11,097

Comments