Placeholder image of a protein
Icon representing a puzzle

2642: Electron Density Reconstruction 129

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
July 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMKNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTNVEEEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLSNPL MVNRIELSRLIGLLLETEKRKNTEQKESGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT

Top groups


  1. Avatar for Go Science 100 pts. 42,359
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 42,308
  3. Avatar for Australia 3. Australia 29 pts. 42,118
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 42,011
  5. Avatar for Contenders 5. Contenders 6 pts. 41,943
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 41,858
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 41,664
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 41,611
  9. Avatar for VeFold 9. VeFold 1 pt. 41,406
  10. Avatar for Andrew's Foldit group 10. Andrew's Foldit group 1 pt. 39,314

  1. Avatar for Anfinsen_slept_here 100 pts. 42,344
  2. Avatar for Galaxie 2. Galaxie Lv 1 47 pts. 42,308
  3. Avatar for LociOiling 3. LociOiling Lv 1 19 pts. 42,281
  4. Avatar for SemperRabbit 4. SemperRabbit Lv 1 7 pts. 42,248
  5. Avatar for alcor29 5. alcor29 Lv 1 2 pts. 42,105
  6. Avatar for georg137 6. georg137 Lv 1 1 pt. 41,943
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 1 pt. 41,292
  8. Avatar for Oscar JV 8. Oscar JV Lv 1 1 pt. 5,125

Comments