Placeholder image of a protein
Icon representing a puzzle

2642: Electron Density Reconstruction 129

Closed since 8 months ago

Novice Overall Prediction Electron Density

Summary


Created
July 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMKNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTNVEEEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLSNPL MVNRIELSRLIGLLLETEKRKNTEQKESGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT

Top groups


  1. Avatar for Go Science 100 pts. 42,359
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 42,308
  3. Avatar for Australia 3. Australia 29 pts. 42,118
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 42,011
  5. Avatar for Contenders 5. Contenders 6 pts. 41,943
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 41,858
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 41,664
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 41,611
  9. Avatar for VeFold 9. VeFold 1 pt. 41,406
  10. Avatar for Andrew's Foldit group 10. Andrew's Foldit group 1 pt. 39,314

  1. Avatar for hada 31. hada Lv 1 5 pts. 41,109
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 5 pts. 41,098
  3. Avatar for rosie4loop 33. rosie4loop Lv 1 4 pts. 41,076
  4. Avatar for Alistair69 34. Alistair69 Lv 1 4 pts. 41,058
  5. Avatar for jamiexq 35. jamiexq Lv 1 3 pts. 40,984
  6. Avatar for ucad 36. ucad Lv 1 3 pts. 40,918
  7. Avatar for Trajan464 37. Trajan464 Lv 1 2 pts. 40,878
  8. Avatar for johngran 38. johngran Lv 1 2 pts. 40,838
  9. Avatar for montezumasrevenge 39. montezumasrevenge Lv 1 2 pts. 40,803
  10. Avatar for AlphaFold2 40. AlphaFold2 Lv 1 2 pts. 40,785

Comments