Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,994
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 8,943

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 9,896
  2. Avatar for grogar7 2. grogar7 Lv 1 93 pts. 9,870
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 9,859
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 81 pts. 9,764
  5. Avatar for SemperRabbit 5. SemperRabbit Lv 1 75 pts. 9,742
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 69 pts. 9,722
  7. Avatar for gmn 7. gmn Lv 1 64 pts. 9,717
  8. Avatar for Dr. Goochie 8. Dr. Goochie Lv 1 59 pts. 9,705
  9. Avatar for akaaka 9. akaaka Lv 1 55 pts. 9,701
  10. Avatar for Galaxie 10. Galaxie Lv 1 50 pts. 9,694

Comments