Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,994
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 8,943
  1. Avatar for georg137 11. georg137 Lv 1 46 pts. 9,681
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 42 pts. 9,679
  3. Avatar for hookedwarm 13. hookedwarm Lv 1 39 pts. 9,662
  4. Avatar for nicobul 14. nicobul Lv 1 36 pts. 9,658
  5. Avatar for MicElephant 15. MicElephant Lv 1 33 pts. 9,657
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 30 pts. 9,647
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 27 pts. 9,623
  8. Avatar for TheGUmmer 18. TheGUmmer Lv 1 25 pts. 9,621
  9. Avatar for zxspectrum 19. zxspectrum Lv 1 23 pts. 9,620
  10. Avatar for g_b 20. g_b Lv 1 20 pts. 9,602

Comments