Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,994
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 8,943

  1. Avatar for pfirth 41. pfirth Lv 1 2 pts. 9,389
  2. Avatar for jausmh 42. jausmh Lv 1 2 pts. 9,385
  3. Avatar for wosser1 43. wosser1 Lv 1 1 pt. 9,369
  4. Avatar for ProfVince 44. ProfVince Lv 1 1 pt. 9,359
  5. Avatar for vuvuvu 45. vuvuvu Lv 1 1 pt. 9,342
  6. Avatar for Mohoernchen 47. Mohoernchen Lv 1 1 pt. 9,285
  7. Avatar for skyleriscool 48. skyleriscool Lv 1 1 pt. 9,271
  8. Avatar for carxo 49. carxo Lv 1 1 pt. 9,232
  9. Avatar for DScott 50. DScott Lv 1 1 pt. 9,231

Comments