Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,994
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 8,943
  1. Avatar for Osiris 51. Osiris Lv 1 1 pt. 9,228
  2. Avatar for crosenquist99 52. crosenquist99 Lv 1 1 pt. 9,218
  3. Avatar for zbp 53. zbp Lv 1 1 pt. 9,214
  4. Avatar for ucad 54. ucad Lv 1 1 pt. 9,212
  5. Avatar for apetrides 55. apetrides Lv 1 1 pt. 9,204
  6. Avatar for Tian00 56. Tian00 Lv 1 1 pt. 9,201
  7. Avatar for Trajan464 57. Trajan464 Lv 1 1 pt. 9,169
  8. Avatar for arotomic 58. arotomic Lv 1 1 pt. 9,143
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 9,112
  10. Avatar for froschi2 60. froschi2 Lv 1 1 pt. 9,073

Comments