Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Go Science 100 pts. 9,900
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 9,870
  3. Avatar for Contenders 3. Contenders 37 pts. 9,681
  4. Avatar for Australia 4. Australia 21 pts. 9,679
  5. Avatar for VeFold 5. VeFold 11 pts. 9,662
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,658
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,621
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 9,591
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,385
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,342

  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 9,900
  2. Avatar for LociOiling 3. LociOiling Lv 1 8 pts. 9,869
  3. Avatar for Galaxie 4. Galaxie Lv 1 2 pts. 9,857
  4. Avatar for alcor29 5. alcor29 Lv 1 1 pt. 9,837
  5. Avatar for SemperRabbit 6. SemperRabbit Lv 1 1 pt. 9,708

Comments