Icon representing a puzzle

2644: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
August 06, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,310
  2. Avatar for Go Science 2. Go Science 56 pts. 12,133
  3. Avatar for Contenders 3. Contenders 29 pts. 12,082
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 11,940
  5. Avatar for Australia 5. Australia 6 pts. 11,938
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 11,844
  7. Avatar for VeFold 7. VeFold 1 pt. 11,473
  8. Avatar for Team China 8. Team China 1 pt. 10,579
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 10,416
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,345

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,290
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 12,133
  3. Avatar for SemperRabbit 3. SemperRabbit Lv 1 88 pts. 12,092
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 82 pts. 12,084
  5. Avatar for BootsMcGraw 5. BootsMcGraw Lv 1 76 pts. 12,082
  6. Avatar for gmn 6. gmn Lv 1 71 pts. 12,063
  7. Avatar for grogar7 7. grogar7 Lv 1 66 pts. 12,028
  8. Avatar for Dr. Goochie 8. Dr. Goochie Lv 1 61 pts. 12,017
  9. Avatar for georg137 9. georg137 Lv 1 57 pts. 11,995
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 53 pts. 11,989

Comments