Icon representing a puzzle

2644: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
August 06, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,310
  2. Avatar for Go Science 2. Go Science 56 pts. 12,133
  3. Avatar for Contenders 3. Contenders 29 pts. 12,082
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 11,940
  5. Avatar for Australia 5. Australia 6 pts. 11,938
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 11,844
  7. Avatar for VeFold 7. VeFold 1 pt. 11,473
  8. Avatar for Team China 8. Team China 1 pt. 10,579
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 10,416
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,345

  1. Avatar for LHOr 21. LHOr Lv 1 21 pts. 11,722
  2. Avatar for zxspectrum 22. zxspectrum Lv 1 19 pts. 11,721
  3. Avatar for Aubade01 23. Aubade01 Lv 1 18 pts. 11,672
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 16 pts. 11,595
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 15 pts. 11,593
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 13 pts. 11,553
  7. Avatar for heather-1 27. heather-1 Lv 1 12 pts. 11,552
  8. Avatar for montezumasrevenge 28. montezumasrevenge Lv 1 11 pts. 11,520
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 10 pts. 11,486
  10. Avatar for BarrySampson 30. BarrySampson Lv 1 9 pts. 11,473

Comments