Icon representing a puzzle

2644: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
August 06, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,310
  2. Avatar for Go Science 2. Go Science 56 pts. 12,133
  3. Avatar for Contenders 3. Contenders 29 pts. 12,082
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 11,940
  5. Avatar for Australia 5. Australia 6 pts. 11,938
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 11,844
  7. Avatar for VeFold 7. VeFold 1 pt. 11,473
  8. Avatar for Team China 8. Team China 1 pt. 10,579
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 10,416
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,345

  1. Avatar for hada 41. hada Lv 1 3 pts. 11,114
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 2 pts. 11,003
  3. Avatar for ucad 43. ucad Lv 1 2 pts. 10,993
  4. Avatar for Osiris 44. Osiris Lv 1 2 pts. 10,963
  5. Avatar for drumpeter18yrs9yrs 45. drumpeter18yrs9yrs Lv 1 2 pts. 10,886
  6. Avatar for Dr.Sillem 46. Dr.Sillem Lv 1 1 pt. 10,859
  7. Avatar for ppp6 47. ppp6 Lv 1 1 pt. 10,811
  8. Avatar for Mohoernchen 48. Mohoernchen Lv 1 1 pt. 10,756
  9. Avatar for Laudrup18 49. Laudrup18 Lv 1 1 pt. 10,722
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 10,720

Comments