Icon representing a puzzle

2647: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since 8 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 13, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,634
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,187

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,667
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 11,649
  3. Avatar for Dr. Goochie 3. Dr. Goochie Lv 1 87 pts. 11,601
  4. Avatar for grogar7 4. grogar7 Lv 1 80 pts. 11,511
  5. Avatar for Aubade01 5. Aubade01 Lv 1 74 pts. 11,470
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 69 pts. 11,470
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 64 pts. 11,429
  8. Avatar for Galaxie 8. Galaxie Lv 1 59 pts. 11,410
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 54 pts. 11,403
  10. Avatar for meatexplosion 10. meatexplosion Lv 1 50 pts. 11,392

Comments