Icon representing a puzzle

2647: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 13, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,634
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,187
  1. Avatar for BarrySampson 21. BarrySampson Lv 1 18 pts. 11,240
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 16 pts. 11,237
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 15 pts. 11,232
  4. Avatar for LHOr 24. LHOr Lv 1 13 pts. 11,222
  5. Avatar for hookedwarm 25. hookedwarm Lv 1 12 pts. 11,218
  6. Avatar for g_b 26. g_b Lv 1 11 pts. 11,209
  7. Avatar for jausmh 27. jausmh Lv 1 9 pts. 11,208
  8. Avatar for alcor29 28. alcor29 Lv 1 8 pts. 11,201
  9. Avatar for Zhang Ruichong 29. Zhang Ruichong Lv 1 8 pts. 11,192
  10. Avatar for georg137 30. georg137 Lv 1 7 pts. 11,170

Comments