Icon representing a puzzle

2647: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
August 13, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Go Science 100 pts. 11,673
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,649
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 11,368
  4. Avatar for Contenders 4. Contenders 21 pts. 11,351
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 11,330
  6. Avatar for Australia 6. Australia 5 pts. 11,254
  7. Avatar for VeFold 7. VeFold 2 pts. 11,240
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,237
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 11,208
  10. Avatar for Team China 10. Team China 1 pt. 11,192

  1. Avatar for SemperRabbit 11. SemperRabbit Lv 1 46 pts. 11,385
  2. Avatar for gmn 12. gmn Lv 1 42 pts. 11,384
  3. Avatar for nicobul 13. nicobul Lv 1 38 pts. 11,368
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 35 pts. 11,351
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 32 pts. 11,330
  6. Avatar for akaaka 16. akaaka Lv 1 29 pts. 11,321
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 27 pts. 11,286
  8. Avatar for taiunplant 18. taiunplant Lv 1 24 pts. 11,279
  9. Avatar for montezumasrevenge 19. montezumasrevenge Lv 1 22 pts. 11,272
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 20 pts. 11,254

Comments