Icon representing a puzzle

2647: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
August 13, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Go Science 100 pts. 11,673
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,649
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 11,368
  4. Avatar for Contenders 4. Contenders 21 pts. 11,351
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 11,330
  6. Avatar for Australia 6. Australia 5 pts. 11,254
  7. Avatar for VeFold 7. VeFold 2 pts. 11,240
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,237
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 11,208
  10. Avatar for Team China 10. Team China 1 pt. 11,192

  1. Avatar for Jenot96 61. Jenot96 Lv 1 1 pt. 10,194
  2. Avatar for Swapper242 62. Swapper242 Lv 1 1 pt. 10,192
  3. Avatar for charsb1973 63. charsb1973 Lv 1 1 pt. 10,191
  4. Avatar for Sammy3c2b1a0 64. Sammy3c2b1a0 Lv 1 1 pt. 10,187
  5. Avatar for Ewink 65. Ewink Lv 1 1 pt. 10,141
  6. Avatar for furi0us 66. furi0us Lv 1 1 pt. 10,133
  7. Avatar for hyyhy1 67. hyyhy1 Lv 1 1 pt. 9,139
  8. Avatar for Popcan 69. Popcan Lv 1 1 pt. 9,090

Comments