Placeholder image of a protein
Icon representing a puzzle

2654: Electron Density Reconstruction 133

Closed since 6 months ago

Novice Overall Prediction Electron Density

Summary

Created
August 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 39,363
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 35,885
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 32,019
  4. Avatar for BearCorp 14. BearCorp 1 pt. 31,515
  1. Avatar for christioanchauvin
    1. christioanchauvin Lv 1
    100 pts. 40,594
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 93 pts. 40,538
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 40,471
  4. Avatar for Galaxie 4. Galaxie Lv 1 81 pts. 40,398
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 75 pts. 40,397
  6. Avatar for Dr. Goochie 6. Dr. Goochie Lv 1 69 pts. 40,392
  7. Avatar for gmn 7. gmn Lv 1 64 pts. 40,296
  8. Avatar for grogar7 8. grogar7 Lv 1 59 pts. 40,262
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 55 pts. 40,252
  10. Avatar for akaaka 10. akaaka Lv 1 50 pts. 40,223

Comments