Placeholder image of a protein
Icon representing a puzzle

2654: Electron Density Reconstruction 133

Closed since 6 months ago

Novice Overall Prediction Electron Density

Summary


Created
August 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 40,594
  2. Avatar for Go Science 2. Go Science 68 pts. 40,538
  3. Avatar for Contenders 3. Contenders 44 pts. 40,482
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 40,471
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 40,200
  6. Avatar for Australia 6. Australia 9 pts. 40,181
  7. Avatar for Team China 7. Team China 5 pts. 39,771
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 39,760
  9. Avatar for VeFold 9. VeFold 1 pt. 39,540
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 39,417

  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 40,482
  2. Avatar for LociOiling 2. LociOiling Lv 1 41 pts. 40,464
  3. Avatar for Galaxie 3. Galaxie Lv 1 14 pts. 40,455
  4. Avatar for alcor29 4. alcor29 Lv 1 4 pts. 40,440
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 1 pt. 40,409
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 40,395

Comments