Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 8 months ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,429
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 12,378
  3. Avatar for grogar7 3. grogar7 Lv 1 88 pts. 12,374
  4. Avatar for SemperRabbit 4. SemperRabbit Lv 1 82 pts. 12,231
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 76 pts. 12,204
  6. Avatar for akaaka 6. akaaka Lv 1 71 pts. 12,200
  7. Avatar for BootsMcGraw 7. BootsMcGraw Lv 1 66 pts. 12,197
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 61 pts. 12,169
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 57 pts. 12,157
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 53 pts. 12,154

Comments