Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714
  1. Avatar for bravosk8erboy 11. bravosk8erboy Lv 1 49 pts. 12,145
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 45 pts. 12,135
  3. Avatar for nicobul 13. nicobul Lv 1 42 pts. 12,130
  4. Avatar for g_b 14. g_b Lv 1 39 pts. 12,098
  5. Avatar for Galaxie 15. Galaxie Lv 1 36 pts. 12,048
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 33 pts. 12,033
  7. Avatar for meatexplosion 17. meatexplosion Lv 1 30 pts. 12,022
  8. Avatar for gmn 18. gmn Lv 1 28 pts. 11,994
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 25 pts. 11,962
  10. Avatar for alcor29 20. alcor29 Lv 1 23 pts. 11,956

Comments