Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 21 pts. 11,940
  2. Avatar for jausmh 22. jausmh Lv 1 19 pts. 11,939
  3. Avatar for ProteinShake 23. ProteinShake Lv 1 18 pts. 11,916
  4. Avatar for TheGUmmer 24. TheGUmmer Lv 1 16 pts. 11,889
  5. Avatar for Zhang Ruichong 25. Zhang Ruichong Lv 1 15 pts. 11,871
  6. Avatar for hookedwarm 26. hookedwarm Lv 1 13 pts. 11,846
  7. Avatar for BarrySampson 27. BarrySampson Lv 1 12 pts. 11,813
  8. Avatar for zxspectrum 28. zxspectrum Lv 1 11 pts. 11,803
  9. Avatar for georg137 29. georg137 Lv 1 10 pts. 11,752
  10. Avatar for dizzywings 30. dizzywings Lv 1 9 pts. 11,726

Comments