Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714

  1. Avatar for Alistair69 31. Alistair69 Lv 1 8 pts. 11,723
  2. Avatar for jtrube1 32. jtrube1 Lv 1 7 pts. 11,701
  3. Avatar for Dr.Sillem 33. Dr.Sillem Lv 1 6 pts. 11,676
  4. Avatar for Joanna_H 34. Joanna_H Lv 1 6 pts. 11,672
  5. Avatar for hada 35. hada Lv 1 5 pts. 11,651
  6. Avatar for montezumasrevenge 36. montezumasrevenge Lv 1 5 pts. 11,647
  7. Avatar for heather-1 37. heather-1 Lv 1 4 pts. 11,621
  8. Avatar for AlphaFold2 38. AlphaFold2 Lv 1 4 pts. 11,620
  9. Avatar for stomjoh 39. stomjoh Lv 1 3 pts. 11,619
  10. Avatar for Aarav_Awasthi 40. Aarav_Awasthi Lv 1 3 pts. 11,566

Comments