Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714
  1. Avatar for borattt 41. borattt Lv 1 3 pts. 11,490
  2. Avatar for pfirth 42. pfirth Lv 1 2 pts. 11,481
  3. Avatar for Trajan464 43. Trajan464 Lv 1 2 pts. 11,468
  4. Avatar for ZiiONIC 44. ZiiONIC Lv 1 2 pts. 11,425
  5. Avatar for RichGuilmain 45. RichGuilmain Lv 1 2 pts. 11,406
  6. Avatar for Larini 46. Larini Lv 1 1 pt. 11,315
  7. Avatar for Vinara 47. Vinara Lv 1 1 pt. 11,309
  8. Avatar for Apothecary1815 48. Apothecary1815 Lv 1 1 pt. 11,302
  9. Avatar for ProfVince 49. ProfVince Lv 1 1 pt. 11,297
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 11,291

Comments