Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 1 pt. 11,286
  2. Avatar for taiunplant 52. taiunplant Lv 1 1 pt. 11,240
  3. Avatar for orily1337 53. orily1337 Lv 1 1 pt. 11,235
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 11,229
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 11,195
  6. Avatar for jamiexq 56. jamiexq Lv 1 1 pt. 11,138
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 11,131
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 11,104
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 11,035
  10. Avatar for RWoodcock 60. RWoodcock Lv 1 1 pt. 11,026

Comments