Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714

  1. Avatar for vyndaquel 61. vyndaquel Lv 1 1 pt. 11,011
  2. Avatar for haleemasha 62. haleemasha Lv 1 1 pt. 10,988
  3. Avatar for Fasodankfds 63. Fasodankfds Lv 1 1 pt. 10,935
  4. Avatar for Simek 64. Simek Lv 1 1 pt. 10,906
  5. Avatar for kedimestant 65. kedimestant Lv 1 1 pt. 10,900
  6. Avatar for frostschutz 66. frostschutz Lv 1 1 pt. 10,886
  7. Avatar for PTHUN7ER 67. PTHUN7ER Lv 1 1 pt. 10,808
  8. Avatar for andrewgood 68. andrewgood Lv 1 1 pt. 10,791
  9. Avatar for AlejonTheBaron 69. AlejonTheBaron Lv 1 1 pt. 10,782
  10. Avatar for Savas 70. Savas Lv 1 1 pt. 10,714

Comments